OXSR1 monoclonal antibody (M06C), clone 1C8
  • OXSR1 monoclonal antibody (M06C), clone 1C8

OXSR1 monoclonal antibody (M06C), clone 1C8

Ref: AB-H00009943-M06C
OXSR1 monoclonal antibody (M06C), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OXSR1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name OXSR1
Gene Alias KIAA1101|OSR1
Gene Description oxidative-stress responsive 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 9943
Clone Number 1C8
Iso type IgG3 Kappa

Enviar un mensaje


OXSR1 monoclonal antibody (M06C), clone 1C8

OXSR1 monoclonal antibody (M06C), clone 1C8