MFN2 monoclonal antibody (M03J), clone 4H8
  • MFN2 monoclonal antibody (M03J), clone 4H8

MFN2 monoclonal antibody (M03J), clone 4H8

Ref: AB-H00009927-M03J
MFN2 monoclonal antibody (M03J), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MFN2.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name MFN2
Gene Alias CMT2A|CMT2A2|CPRP1|HSG|KIAA0214|MARF
Gene Description mitofusin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MFN2 (NP_055689, 661 a.a. ~ 757 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9927
Clone Number 4H8
Iso type IgG2a Kappa

Enviar un mensaje


MFN2 monoclonal antibody (M03J), clone 4H8

MFN2 monoclonal antibody (M03J), clone 4H8