USP52 monoclonal antibody (M01), clone 6A7
  • USP52 monoclonal antibody (M01), clone 6A7

USP52 monoclonal antibody (M01), clone 6A7

Ref: AB-H00009924-M01
USP52 monoclonal antibody (M01), clone 6A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP52.
Información adicional
Size 100 ug
Gene Name PAN2
Gene Alias FLJ39360|KIAA0710|USP52|hPAN2
Gene Description PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9924
Clone Number 6A7
Iso type IgG1 Kappa

Enviar un mensaje


USP52 monoclonal antibody (M01), clone 6A7

USP52 monoclonal antibody (M01), clone 6A7