CNAP1 monoclonal antibody (M01), clone 4C12
  • CNAP1 monoclonal antibody (M01), clone 4C12

CNAP1 monoclonal antibody (M01), clone 4C12

Ref: AB-H00009918-M01
CNAP1 monoclonal antibody (M01), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNAP1.
Información adicional
Size 100 ug
Gene Name NCAPD2
Gene Alias CAP-D2|CNAP1|KIAA0159|hCAP-D2
Gene Description non-SMC condensin I complex, subunit D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9918
Clone Number 4C12
Iso type IgG1 Kappa

Enviar un mensaje


CNAP1 monoclonal antibody (M01), clone 4C12

CNAP1 monoclonal antibody (M01), clone 4C12