CNAP1 polyclonal antibody (A01)
  • CNAP1 polyclonal antibody (A01)

CNAP1 polyclonal antibody (A01)

Ref: AB-H00009918-A01
CNAP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNAP1.
Información adicional
Size 50 uL
Gene Name NCAPD2
Gene Alias CAP-D2|CNAP1|KIAA0159|hCAP-D2
Gene Description non-SMC condensin I complex, subunit D2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9918

Enviar un mensaje


CNAP1 polyclonal antibody (A01)

CNAP1 polyclonal antibody (A01)