SV2A polyclonal antibody (A01)
  • SV2A polyclonal antibody (A01)

SV2A polyclonal antibody (A01)

Ref: AB-H00009900-A01
SV2A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SV2A.
Información adicional
Size 50 uL
Gene Name SV2A
Gene Alias KIAA0736|SV2
Gene Description synaptic vesicle glycoprotein 2A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SV2A (NP_055664, 474 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9900

Enviar un mensaje


SV2A polyclonal antibody (A01)

SV2A polyclonal antibody (A01)