SNAP91 polyclonal antibody (A01)
  • SNAP91 polyclonal antibody (A01)

SNAP91 polyclonal antibody (A01)

Ref: AB-H00009892-A01
SNAP91 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SNAP91.
Información adicional
Size 50 uL
Gene Name SNAP91
Gene Alias AP180|CALM|DKFZp781O0519|KIAA0656
Gene Description synaptosomal-associated protein, 91kDa homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAP91 (NP_055656, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9892

Enviar un mensaje


SNAP91 polyclonal antibody (A01)

SNAP91 polyclonal antibody (A01)