SEC24D polyclonal antibody (A01)
  • SEC24D polyclonal antibody (A01)

SEC24D polyclonal antibody (A01)

Ref: AB-H00009871-A01
SEC24D polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEC24D.
Información adicional
Size 50 uL
Gene Name SEC24D
Gene Alias FLJ43974|KIAA0755
Gene Description SEC24 family, member D (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9871

Enviar un mensaje


SEC24D polyclonal antibody (A01)

SEC24D polyclonal antibody (A01)