KIAA0317 polyclonal antibody (A01)
  • KIAA0317 polyclonal antibody (A01)

KIAA0317 polyclonal antibody (A01)

Ref: AB-H00009870-A01
KIAA0317 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KIAA0317.
Información adicional
Size 50 uL
Gene Name KIAA0317
Gene Alias -
Gene Description KIAA0317
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSCKVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVNQEVLQEPNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIAA0317 (NP_055636, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9870

Enviar un mensaje


KIAA0317 polyclonal antibody (A01)

KIAA0317 polyclonal antibody (A01)