TOMM70A purified MaxPab mouse polyclonal antibody (B01P)
  • TOMM70A purified MaxPab mouse polyclonal antibody (B01P)

TOMM70A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009868-B01P
TOMM70A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOMM70A protein.
Información adicional
Size 50 ug
Gene Name TOMM70A
Gene Alias FLJ90470
Gene Description translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOMM70A (NP_055635, 1 a.a. ~ 608 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9868

Enviar un mensaje


TOMM70A purified MaxPab mouse polyclonal antibody (B01P)

TOMM70A purified MaxPab mouse polyclonal antibody (B01P)