EPM2AIP1 monoclonal antibody (M01), clone 3H7
  • EPM2AIP1 monoclonal antibody (M01), clone 3H7

EPM2AIP1 monoclonal antibody (M01), clone 3H7

Ref: AB-H00009852-M01
EPM2AIP1 monoclonal antibody (M01), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1.
Información adicional
Size 100 ug
Gene Name EPM2AIP1
Gene Alias FLJ11207|KIAA0766
Gene Description EPM2A (laforin) interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9852
Clone Number 3H7
Iso type IgG2b Kappa

Enviar un mensaje


EPM2AIP1 monoclonal antibody (M01), clone 3H7

EPM2AIP1 monoclonal antibody (M01), clone 3H7