EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)

EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009852-D01P
EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EPM2AIP1 protein.
Información adicional
Size 100 ug
Gene Name EPM2AIP1
Gene Alias FLJ11207|KIAA0766
Gene Description EPM2A (laforin) interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MWMTPKRSKMEVDEALVFRPEWTQRYLVVEPPEGDGALCLVCRRLIVATRERDVRRHYEAEHEYYERYVADGERAALVERLRQGDLPVASFTPEERAARAGLGLCRLLALKGRGWGEGDFVYQCMEVLLREVLPEHVSVLQGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGPELEVQEDLLTIINLTHHFSVGALMSAILESLQTAGLSLQRMVGLTTTHTLRMIGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPM2AIP1 (NP_055620.1, 1 a.a. ~ 607 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9852

Enviar un mensaje


EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)

EPM2AIP1 purified MaxPab rabbit polyclonal antibody (D01P)