EPM2AIP1 polyclonal antibody (A01)
  • EPM2AIP1 polyclonal antibody (A01)

EPM2AIP1 polyclonal antibody (A01)

Ref: AB-H00009852-A01
EPM2AIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPM2AIP1.
Información adicional
Size 50 uL
Gene Name EPM2AIP1
Gene Alias FLJ11207|KIAA0766
Gene Description EPM2A (laforin) interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9852

Enviar un mensaje


EPM2AIP1 polyclonal antibody (A01)

EPM2AIP1 polyclonal antibody (A01)