GAB2 purified MaxPab mouse polyclonal antibody (B01P)
  • GAB2 purified MaxPab mouse polyclonal antibody (B01P)

GAB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009846-B01P
GAB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GAB2 protein.
Información adicional
Size 50 ug
Gene Name GAB2
Gene Alias KIAA0571
Gene Description GRB2-associated binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQAEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GAB2 (NP_536739, 1 a.a. ~ 676 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9846

Enviar un mensaje


GAB2 purified MaxPab mouse polyclonal antibody (B01P)

GAB2 purified MaxPab mouse polyclonal antibody (B01P)