HEPH monoclonal antibody (M01), clone 2D3
  • HEPH monoclonal antibody (M01), clone 2D3

HEPH monoclonal antibody (M01), clone 2D3

Ref: AB-H00009843-M01
HEPH monoclonal antibody (M01), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HEPH.
Información adicional
Size 100 ug
Gene Name HEPH
Gene Alias CPL|KIAA0698
Gene Description hephaestin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEPH (NP_620074, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9843
Clone Number 2D3
Iso type IgG2a Kappa

Enviar un mensaje


HEPH monoclonal antibody (M01), clone 2D3

HEPH monoclonal antibody (M01), clone 2D3