HEPH polyclonal antibody (A01)
  • HEPH polyclonal antibody (A01)

HEPH polyclonal antibody (A01)

Ref: AB-H00009843-A01
HEPH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HEPH.
Información adicional
Size 50 uL
Gene Name HEPH
Gene Alias CPL|KIAA0698
Gene Description hephaestin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEPH (NP_620074, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9843

Enviar un mensaje


HEPH polyclonal antibody (A01)

HEPH polyclonal antibody (A01)