SPATA2 MaxPab rabbit polyclonal antibody (D01)
  • SPATA2 MaxPab rabbit polyclonal antibody (D01)

SPATA2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009825-D01
SPATA2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPATA2 protein.
Información adicional
Size 100 uL
Gene Name SPATA2
Gene Alias FLJ13167|KIAA0757|PD1|tamo
Gene Description spermatogenesis associated 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRPGSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAKDYYKPRVTKPSRSVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPATA2 (NP_006029.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9825

Enviar un mensaje


SPATA2 MaxPab rabbit polyclonal antibody (D01)

SPATA2 MaxPab rabbit polyclonal antibody (D01)