ARMCX2 polyclonal antibody (A01)
  • ARMCX2 polyclonal antibody (A01)

ARMCX2 polyclonal antibody (A01)

Ref: AB-H00009823-A01
ARMCX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARMCX2.
Información adicional
Size 50 uL
Gene Name ARMCX2
Gene Alias ALEX2|KIAA0512|MGC13343|MGC8742
Gene Description armadillo repeat containing, X-linked 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYVESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARMCX2 (NP_055597, 508 a.a. ~ 599 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9823

Enviar un mensaje


ARMCX2 polyclonal antibody (A01)

ARMCX2 polyclonal antibody (A01)