GIT2 purified MaxPab mouse polyclonal antibody (B01P)
  • GIT2 purified MaxPab mouse polyclonal antibody (B01P)

GIT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009815-B01P
GIT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GIT2 protein.
Información adicional
Size 50 ug
Gene Name GIT2
Gene Alias CAT-2|DKFZp686G01261|KIAA0148|MGC760
Gene Description G protein-coupled receptor kinase interacting ArfGAP 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Ti,WB-Tr
Immunogen Prot. Seq MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GIT2 (NP_631940.1, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9815

Enviar un mensaje


GIT2 purified MaxPab mouse polyclonal antibody (B01P)

GIT2 purified MaxPab mouse polyclonal antibody (B01P)