IHPK1 polyclonal antibody (A01)
  • IHPK1 polyclonal antibody (A01)

IHPK1 polyclonal antibody (A01)

Ref: AB-H00009807-A01
IHPK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IHPK1.
Información adicional
Size 50 uL
Gene Name IP6K1
Gene Alias IHPK1|MGC9925|PiUS
Gene Description inositol hexakisphosphate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IHPK1 (NP_001006115, 182 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9807

Enviar un mensaje


IHPK1 polyclonal antibody (A01)

IHPK1 polyclonal antibody (A01)