TOMM20 polyclonal antibody (A01)
  • TOMM20 polyclonal antibody (A01)

TOMM20 polyclonal antibody (A01)

Ref: AB-H00009804-A01
TOMM20 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TOMM20.
Información adicional
Size 50 uL
Gene Name TOMM20
Gene Alias KIAA0016|MAS20|MGC117367|MOM19|TOM20
Gene Description translocase of outer mitochondrial membrane 20 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9804

Enviar un mensaje


TOMM20 polyclonal antibody (A01)

TOMM20 polyclonal antibody (A01)