DAZAP2 polyclonal antibody (A01)
  • DAZAP2 polyclonal antibody (A01)

DAZAP2 polyclonal antibody (A01)

Ref: AB-H00009802-A01
DAZAP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DAZAP2.
Información adicional
Size 50 uL
Gene Name DAZAP2
Gene Alias KIAA0058|MGC14319|MGC766|PRTB
Gene Description DAZ associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAZAP2 (NP_055579, 93 a.a. ~ 168 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9802

Enviar un mensaje


DAZAP2 polyclonal antibody (A01)

DAZAP2 polyclonal antibody (A01)