MAML1 polyclonal antibody (A01)
  • MAML1 polyclonal antibody (A01)

MAML1 polyclonal antibody (A01)

Ref: AB-H00009794-A01
MAML1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAML1.
Información adicional
Size 50 uL
Gene Name MAML1
Gene Alias KIAA0200|Mam-1|Mam1
Gene Description mastermind-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEQEKQQFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAML1 (NP_055572, 655 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9794

Enviar un mensaje


MAML1 polyclonal antibody (A01)

MAML1 polyclonal antibody (A01)