ZFYVE16 polyclonal antibody (A01)
  • ZFYVE16 polyclonal antibody (A01)

ZFYVE16 polyclonal antibody (A01)

Ref: AB-H00009765-A01
ZFYVE16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZFYVE16.
Información adicional
Size 50 uL
Gene Name ZFYVE16
Gene Alias DKFZp686E13162|ENDOFIN|KIAA0305
Gene Description zinc finger, FYVE domain containing 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZFYVE16 (NP_055548, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9765

Enviar un mensaje


ZFYVE16 polyclonal antibody (A01)

ZFYVE16 polyclonal antibody (A01)