ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)
  • ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009762-B01P
ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ProSAPiP1 protein.
Información adicional
Size 50 ug
Gene Name ProSAPiP1
Gene Alias KIAA0552
Gene Description ProSAPiP1 protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLAMGSVGSGVAHAQEFAMKSVGTRTGGGGSQGSFPGPRGSGSGASRERPGRYPSEDKGLANSLYLNGELRGSDHTDVCGNVVGSSGGSSSSGGSDKAPPQYREPSHPPKLLATSGKLDQCSEPLVRPSAFKPVVPKNFHSMQNLCPPQTNGTPEGRQGPGGLKGGLDKSRTMTPAGGSGSGLSDSGRNSLTSLPTYSSSYSQHLAPLSASTSHINRIGTAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ProSAPiP1 (NP_055546.1, 1 a.a. ~ 673 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9762

Enviar un mensaje


ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)

ProSAPiP1 purified MaxPab mouse polyclonal antibody (B01P)