PCDHA9 monoclonal antibody (M04), clone 3C1
  • PCDHA9 monoclonal antibody (M04), clone 3C1

PCDHA9 monoclonal antibody (M04), clone 3C1

Ref: AB-H00009752-M04
PCDHA9 monoclonal antibody (M04), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHA9.
Información adicional
Size 100 ug
Gene Name PCDHA9
Gene Alias KIAA0345|PCDH-ALPHA9
Gene Description protocadherin alpha 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGTVIALISVIDLDADA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHA9 (NP_114063, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9752
Clone Number 3C1
Iso type IgG1 Kappa

Enviar un mensaje


PCDHA9 monoclonal antibody (M04), clone 3C1

PCDHA9 monoclonal antibody (M04), clone 3C1