PCDHA9 polyclonal antibody (A01)
  • PCDHA9 polyclonal antibody (A01)

PCDHA9 polyclonal antibody (A01)

Ref: AB-H00009752-A01
PCDHA9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCDHA9.
Información adicional
Size 50 uL
Gene Name PCDHA9
Gene Alias KIAA0345|PCDH-ALPHA9
Gene Description protocadherin alpha 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVSPDIKSKFHMDPLSGAITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTLLVEVVDVNDNAPQLTIKTLSVPVKEDAQLGTVIALISVIDLDADA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHA9 (NP_114063, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9752

Enviar un mensaje


PCDHA9 polyclonal antibody (A01)

PCDHA9 polyclonal antibody (A01)