SNPH monoclonal antibody (M03), clone 3B6
  • SNPH monoclonal antibody (M03), clone 3B6

SNPH monoclonal antibody (M03), clone 3B6

Ref: AB-H00009751-M03
SNPH monoclonal antibody (M03), clone 3B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNPH.
Información adicional
Size 100 ug
Gene Name SNPH
Gene Alias KIAA0374|MGC46096|bA314N13.5
Gene Description syntaphilin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNPH (NP_055538.2, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9751
Clone Number 3B6
Iso type IgG2a Kappa

Enviar un mensaje


SNPH monoclonal antibody (M03), clone 3B6

SNPH monoclonal antibody (M03), clone 3B6