HERPUD1 monoclonal antibody (M14), clone 2F4
  • HERPUD1 monoclonal antibody (M14), clone 2F4

HERPUD1 monoclonal antibody (M14), clone 2F4

Ref: AB-H00009709-M14
HERPUD1 monoclonal antibody (M14), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant HERPUD1.
Información adicional
Size 100 ug
Gene Name HERPUD1
Gene Alias HERP|KIAA0025|Mif1|SUP
Gene Description homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HERPUD1 (AAH32673, 1 a.a. ~ 391 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9709
Clone Number 2F4
Iso type IgG2a Kappa

Enviar un mensaje


HERPUD1 monoclonal antibody (M14), clone 2F4

HERPUD1 monoclonal antibody (M14), clone 2F4