PCDHGA8 monoclonal antibody (M01), clone 1C11
  • PCDHGA8 monoclonal antibody (M01), clone 1C11

PCDHGA8 monoclonal antibody (M01), clone 1C11

Ref: AB-H00009708-M01
PCDHGA8 monoclonal antibody (M01), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGA8.
Información adicional
Size 100 ug
Gene Name PCDHGA8
Gene Alias KIAA0327|PCDH-GAMMA-A8
Gene Description protocadherin gamma subfamily A, 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq LENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA8 (NP_114477, 357 a.a. ~ 444 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9708
Clone Number 1C11
Iso type IgG2a Kappa

Enviar un mensaje


PCDHGA8 monoclonal antibody (M01), clone 1C11

PCDHGA8 monoclonal antibody (M01), clone 1C11