ULK2 monoclonal antibody (M04), clone 1A1
  • ULK2 monoclonal antibody (M04), clone 1A1

ULK2 monoclonal antibody (M04), clone 1A1

Ref: AB-H00009706-M04
ULK2 monoclonal antibody (M04), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ULK2.
Información adicional
Size 100 ug
Gene Name ULK2
Gene Alias KIAA0623|Unc51.2
Gene Description unc-51-like kinase 2 (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9706
Clone Number 1A1
Iso type IgG2a Kappa

Enviar un mensaje


ULK2 monoclonal antibody (M04), clone 1A1

ULK2 monoclonal antibody (M04), clone 1A1