CEP57 monoclonal antibody (M02), clone 1E9
  • CEP57 monoclonal antibody (M02), clone 1E9

CEP57 monoclonal antibody (M02), clone 1E9

Ref: AB-H00009702-M02
CEP57 monoclonal antibody (M02), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CEP57.
Información adicional
Size 100 ug
Gene Name CEP57
Gene Alias KIAA0092|PIG8|TSP57
Gene Description centrosomal protein 57kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEP57 (NP_055494, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9702
Clone Number 1E9
Iso type IgG1 Kappa

Enviar un mensaje


CEP57 monoclonal antibody (M02), clone 1E9

CEP57 monoclonal antibody (M02), clone 1E9