CEP57 MaxPab rabbit polyclonal antibody (D01)
  • CEP57 MaxPab rabbit polyclonal antibody (D01)

CEP57 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009702-D01
CEP57 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CEP57 protein.
Información adicional
Size 100 uL
Gene Name CEP57
Gene Alias KIAA0092|PIG8|TSP57
Gene Description centrosomal protein 57kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CEP57 (NP_055494.2, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9702

Enviar un mensaje


CEP57 MaxPab rabbit polyclonal antibody (D01)

CEP57 MaxPab rabbit polyclonal antibody (D01)