HS2ST1 MaxPab rabbit polyclonal antibody (D01)
  • HS2ST1 MaxPab rabbit polyclonal antibody (D01)

HS2ST1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009653-D01
HS2ST1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HS2ST1 protein.
Información adicional
Size 100 uL
Gene Name HS2ST1
Gene Alias FLJ11317|KIAA0448|MGC131986|dJ604K5.2
Gene Description heparan sulfate 2-O-sulfotransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HS2ST1 (AAH25990.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9653

Enviar un mensaje


HS2ST1 MaxPab rabbit polyclonal antibody (D01)

HS2ST1 MaxPab rabbit polyclonal antibody (D01)