PPM1F monoclonal antibody (M01), clone 2A9
  • PPM1F monoclonal antibody (M01), clone 2A9

PPM1F monoclonal antibody (M01), clone 2A9

Ref: AB-H00009647-M01
PPM1F monoclonal antibody (M01), clone 2A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPM1F.
Información adicional
Size 100 ug
Gene Name PPM1F
Gene Alias CaMKPase|FEM-2|KIAA0015|POPX2|hFEM-2
Gene Description protein phosphatase 1F (PP2C domain containing)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9647
Clone Number 2A9
Iso type IgG2a Kappa

Enviar un mensaje


PPM1F monoclonal antibody (M01), clone 2A9

PPM1F monoclonal antibody (M01), clone 2A9