ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)
  • ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)

ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009639-B01P
ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARHGEF10 protein.
Información adicional
Size 50 ug
Gene Name ARHGEF10
Gene Alias DKFZp686H0726|GEF10|MGC131664
Gene Description Rho guanine nucleotide exchange factor (GEF) 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MENPEEAIYDDVPRENSDSEPDEMIYDDVENGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGIPRSFLRSNHKKQMQKLVKAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRSSLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQVVRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALASRVSEWDSVEMIGVVFVASFSKSMVLDAYSEYVNNFST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARHGEF10 (AAH40474.1, 1 a.a. ~ 380 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9639

Enviar un mensaje


ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)

ARHGEF10 purified MaxPab mouse polyclonal antibody (B01P)