FEZ1 purified MaxPab mouse polyclonal antibody (B02P)
  • FEZ1 purified MaxPab mouse polyclonal antibody (B02P)

FEZ1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00009638-B02P
FEZ1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FEZ1 protein.
Información adicional
Size 50 ug
Gene Name FEZ1
Gene Alias -
Gene Description fasciculation and elongation protein zeta 1 (zygin I)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FEZ1 (NP_005094.1, 1 a.a. ~ 392 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9638

Enviar un mensaje


FEZ1 purified MaxPab mouse polyclonal antibody (B02P)

FEZ1 purified MaxPab mouse polyclonal antibody (B02P)