ISG15 purified MaxPab rabbit polyclonal antibody (D01P)
  • ISG15 purified MaxPab rabbit polyclonal antibody (D01P)

ISG15 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009636-D01P
ISG15 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ISG15 protein.
Información adicional
Size 100 ug
Gene Name ISG15
Gene Alias G1P2|IFI15|UCRP
Gene Description ISG15 ubiquitin-like modifier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ISG15 (ENSP00000368699, 1 a.a. ~ 165 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9636

Enviar un mensaje


ISG15 purified MaxPab rabbit polyclonal antibody (D01P)

ISG15 purified MaxPab rabbit polyclonal antibody (D01P)