CLCA2 monoclonal antibody (M05), clone 1D5
  • CLCA2 monoclonal antibody (M05), clone 1D5

CLCA2 monoclonal antibody (M05), clone 1D5

Ref: AB-H00009635-M05
CLCA2 monoclonal antibody (M05), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CLCA2.
Información adicional
Size 100 ug
Gene Name CLCA2
Gene Alias CACC|CACC3|CLCRG2|CaCC-3|FLJ97885
Gene Description chloride channel regulator 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCA2 (NP_006527, 300 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9635
Clone Number 1D5
Iso type IgG2a Kappa

Enviar un mensaje


CLCA2 monoclonal antibody (M05), clone 1D5

CLCA2 monoclonal antibody (M05), clone 1D5