CLCA2 polyclonal antibody (A01)
  • CLCA2 polyclonal antibody (A01)

CLCA2 polyclonal antibody (A01)

Ref: AB-H00009635-A01
CLCA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CLCA2.
Información adicional
Size 50 uL
Gene Name CLCA2
Gene Alias CACC|CACC3|CLCRG2|CaCC-3|FLJ97885
Gene Description chloride channel regulator 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLCA2 (NP_006527, 300 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9635

Enviar un mensaje


CLCA2 polyclonal antibody (A01)

CLCA2 polyclonal antibody (A01)