GNA14 monoclonal antibody (M06), clone 2H8
  • GNA14 monoclonal antibody (M06), clone 2H8

GNA14 monoclonal antibody (M06), clone 2H8

Ref: AB-H00009630-M06
GNA14 monoclonal antibody (M06), clone 2H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GNA14.
Información adicional
Size 100 ug
Gene Name GNA14
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), alpha 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Specificity This antibody cross-reacts with human GNA11.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9630
Clone Number 2H8
Iso type IgG1 Kappa

Enviar un mensaje


GNA14 monoclonal antibody (M06), clone 2H8

GNA14 monoclonal antibody (M06), clone 2H8