SNCAIP monoclonal antibody (M01), clone 2A8
  • SNCAIP monoclonal antibody (M01), clone 2A8

SNCAIP monoclonal antibody (M01), clone 2A8

Ref: AB-H00009627-M01
SNCAIP monoclonal antibody (M01), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNCAIP.
Información adicional
Size 100 ug
Gene Name SNCAIP
Gene Alias MGC39814|SYPH1
Gene Description synuclein, alpha interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNCAIP (NP_005451, 206 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9627
Clone Number 2A8
Iso type IgG1 Kappa

Enviar un mensaje


SNCAIP monoclonal antibody (M01), clone 2A8

SNCAIP monoclonal antibody (M01), clone 2A8