SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)
  • SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)

SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009627-D01P
SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNCAIP protein.
Información adicional
Size 100 ug
Gene Name SNCAIP
Gene Alias MGC39814|SYPH1
Gene Description synuclein, alpha interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTYLIQSHHSRRSQNCAEDVIRKTKTDQNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNCAIP (AAH94759.1, 1 a.a. ~ 603 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9627

Enviar un mensaje


SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)

SNCAIP purified MaxPab rabbit polyclonal antibody (D01P)