AATK monoclonal antibody (M02), clone 2D10
  • AATK monoclonal antibody (M02), clone 2D10

AATK monoclonal antibody (M02), clone 2D10

Ref: AB-H00009625-M02
AATK monoclonal antibody (M02), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AATK.
Información adicional
Size 100 ug
Gene Name AATK
Gene Alias AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP
Gene Description apoptosis-associated tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9625
Clone Number 2D10
Iso type IgG1 Kappa

Enviar un mensaje


AATK monoclonal antibody (M02), clone 2D10

AATK monoclonal antibody (M02), clone 2D10