MTRF1 purified MaxPab mouse polyclonal antibody (B01P)
  • MTRF1 purified MaxPab mouse polyclonal antibody (B01P)

MTRF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009617-B01P
MTRF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MTRF1 protein.
Información adicional
Size 50 ug
Gene Name MTRF1
Gene Alias MGC47721|MRF1|MTTRF1|RF1
Gene Description mitochondrial translational release factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTRF1 (ENSP00000239852, 1 a.a. ~ 151 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9617

Enviar un mensaje


MTRF1 purified MaxPab mouse polyclonal antibody (B01P)

MTRF1 purified MaxPab mouse polyclonal antibody (B01P)