RIN1 monoclonal antibody (M01), clone 1D11
  • RIN1 monoclonal antibody (M01), clone 1D11

RIN1 monoclonal antibody (M01), clone 1D11

Ref: AB-H00009610-M01
RIN1 monoclonal antibody (M01), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RIN1.
Información adicional
Size 100 ug
Gene Name RIN1
Gene Alias -
Gene Description Ras and Rab interactor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIN1 (AAH14417, 646 a.a. ~ 755 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9610
Clone Number 1D11
Iso type IgG1 kappa

Enviar un mensaje


RIN1 monoclonal antibody (M01), clone 1D11

RIN1 monoclonal antibody (M01), clone 1D11