RAB36 monoclonal antibody (M01), clone 6A6
  • RAB36 monoclonal antibody (M01), clone 6A6

RAB36 monoclonal antibody (M01), clone 6A6

Ref: AB-H00009609-M01
RAB36 monoclonal antibody (M01), clone 6A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB36.
Información adicional
Size 50 ug
Gene Name RAB36
Gene Alias -
Gene Description RAB36, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq LVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB36 (NP_004905, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9609
Clone Number 6A6
Iso type IgG2a Kappa

Enviar un mensaje


RAB36 monoclonal antibody (M01), clone 6A6

RAB36 monoclonal antibody (M01), clone 6A6