RNF14 purified MaxPab rabbit polyclonal antibody (D01P)
  • RNF14 purified MaxPab rabbit polyclonal antibody (D01P)

RNF14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009604-D01P
RNF14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RNF14 protein.
Información adicional
Size 100 ug
Gene Name RNF14
Gene Alias ARA54|FLJ26004|HFB30|HRIHFB2038|TRIAD2
Gene Description ring finger protein 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF14 (NP_899645.1, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9604

Enviar un mensaje


RNF14 purified MaxPab rabbit polyclonal antibody (D01P)

RNF14 purified MaxPab rabbit polyclonal antibody (D01P)