PDIA4 monoclonal antibody (M02), clone 2H3
  • PDIA4 monoclonal antibody (M02), clone 2H3

PDIA4 monoclonal antibody (M02), clone 2H3

Ref: AB-H00009601-M02
PDIA4 monoclonal antibody (M02), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PDIA4.
Información adicional
Size 100 ug
Gene Name PDIA4
Gene Alias ERP70|ERP72
Gene Description protein disulfide isomerase family A, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDIA4 (NP_004902, 355 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9601
Clone Number 2H3
Iso type IgG2a Kappa

Enviar un mensaje


PDIA4 monoclonal antibody (M02), clone 2H3

PDIA4 monoclonal antibody (M02), clone 2H3