PDIA4 polyclonal antibody (A01)
  • PDIA4 polyclonal antibody (A01)

PDIA4 polyclonal antibody (A01)

Ref: AB-H00009601-A01
PDIA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDIA4.
Información adicional
Size 50 uL
Gene Name PDIA4
Gene Alias ERP70|ERP72
Gene Description protein disulfide isomerase family A, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDIA4 (NP_004902, 355 a.a. ~ 464 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9601

Enviar un mensaje


PDIA4 polyclonal antibody (A01)

PDIA4 polyclonal antibody (A01)